Innovative Web Directory
Get a free and reliable text link to your website with no further obligations.
West Virginia Medical Malpractice Attorney
westvirginiamedicalmalpracticelawyer.org
General
WhoIs
Archive
Description
Tiano O’Dell is a Charleston based medical malpractice firm that serves clients throughout the state of West Virginia for medical malpractice and other negligence cases. Physicians and medical practitioners have a duty to provide proper medical care that is in compliance with medical protocols and standards. If a medical professional does not perform this high standard of care, it can result in an injury, illness, infection or even death. The practitioner may be found liable for negligent conduct,also known as medical malpractice.If you or a loved one were injured or harmed by a medical professional who was negligent, you may be able to receive compensation in a medical malpractice claim. A confidential case review at the law firm of Tiano O'Dell is available to discuss your case. Contact the attorney's at Tiano O'Dell today for your free medical malpractice case review consultation. Our dedicated staff is here to help you or your loved one in their time of need.
Domain
westvirginiamedicalmalpracticelawyer.org
Meta Keywords
West Virginia Medical Malpractice Attorney,Tiano O'Dell West Virginia Medical Malpractice Lawyers, Charleston Medical Malpractice Attorneys
Date added
Tuesday 02, 2014
R-TT Articles